General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6H677",
        "id": "EXB14_ORYSJ",
        "source_organism": {
            "taxId": "39947",
            "scientificName": "Oryza sativa subsp. japonica",
            "fullName": "Oryza sativa subsp. japonica (Rice)"
        },
        "name": "Putative expansin-B14",
        "description": [
            "May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity)"
        ],
        "length": 273,
        "sequence": "MALAAKLLPSIVAFVALACCVLRSSVASVDHHRKLSGWSIGGATWYGPANGSGTDGGACGYQGDVGQPPFNSMIAAGSPSIYESGKGCGSCYQVKCSGNPSCSGKPVTVVLTDLCPGGACLEEPVHFDLSGTAFGAMAKPGQDDQLRNAGKLPVQYARVPCKWQGVDIAFRVDAGSNQYYLAVLVEDEDGDGDLSAVDLMQSGGSGGGGSWAAMQQSWGAVWKYNSGPAPLQAPMSIRLTSGSGRTLVASNVIPAGWQPGGTYRSIVNFRRED",
        "proteome": "UP000059680",
        "gene": "EXPB14",
        "go_terms": [
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0019953",
                "name": "sexual reproduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c97f4db8fee7db10ec81bb72b2815f6051c5b340",
        "counters": {
            "domain_architectures": 18404,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18404
        }
    }
}