GET /api/protein/UniProt/Q6GHQ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6GHQ6",
"id": "RSMH_STAAR",
"source_organism": {
"taxId": "282458",
"scientificName": "Staphylococcus aureus (strain MRSA252)",
"fullName": "Staphylococcus aureus (strain MRSA252)"
},
"name": "Ribosomal RNA small subunit methyltransferase H",
"description": [
"Specifically methylates the N4 position of cytidine in position 1402 (C1402) of 16S rRNA"
],
"length": 311,
"sequence": "MFHHISVMLNETIDYLNVKENGVYIDCTLGGAGHALYLLNQLNDDGRLIAIDQDQTAIDNAKEVLKDHLHKVTFVHSNFRELTQILKDLNIEKVDGIYYDLGVSSPQLDIPERGFSYHHDATLDMRMDQTQELTAYEIVNNWSYEALVKIFYRYGEEKFSKQIARRIEAHREQQPITTTLELVDIIKEGIPAKARRKGGHPAKRVFQALRIAVNDELSAFEDSIEQAIELVKVDGRISVITFHSLEDRLCKQVFQEYEKGPEVPRGLPVIPEAYTPKLKRVNRKPITATEEDLDDNNRARSAKLRVAEILK",
"proteome": null,
"gene": "rsmH",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6a840ea143b2d688f097d7e610544d1e2b1e6dc6",
"counters": {
"domain_architectures": 29917,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 29917
}
}
}