HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6G0C9",
"id": "ISPH_BARQU",
"source_organism": {
"taxId": "283165",
"scientificName": "Bartonella quintana (strain Toulouse)",
"fullName": "Bartonella quintana (strain Toulouse)"
},
"name": "4-hydroxy-3-methylbut-2-enyl diphosphate reductase",
"description": [
"Catalyzes the conversion of 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate (HMBPP) into a mixture of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). Acts in the terminal step of the DOXP/MEP pathway for isoprenoid precursor biosynthesis"
],
"length": 340,
"sequence": "MSVLSPLIIRLCSPRGFCAGVDRAIQIVLLALKKYGAPVYVRHEIVHNRYVVEGLQQRGAIFVEELDEIPEEHRNQPVVFSAHGVPKSVPEQADRYNLFYLDATCPLVSKVHKQAMRHQRHGRHVILIGHAGHPEVIGTMGQLEKGAVTLIETIEDALHYQPDDPDKLGFVTQTTLSVEDTAGILDVLQRRFPALEPPAAESICYATTNRQNAVKAAALGSDLFLIVGAPNSSNSRRLVEVAERFGARQSILVQRADEIDFDRLGPLSVVSLSAGASAPEIIVDEIISAFRERYDVTIELSETVVEMETFLVNRELRNVILTPQDMAFVNGQSETLKNKN",
"proteome": null,
"gene": "ispH",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051745",
"name": "4-hydroxy-3-methylbut-2-enyl diphosphate reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019288",
"name": "isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050992",
"name": "dimethylallyl diphosphate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fcbea5256286b22a5f6231f48f5b4e45375830bf",
"counters": {
"domain_architectures": 23559,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 2,
"ncbifam": 2,
"hamap": 1,
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 23559
}
}
}