GET /api/protein/UniProt/Q6G0C9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6G0C9",
        "id": "ISPH_BARQU",
        "source_organism": {
            "taxId": "283165",
            "scientificName": "Bartonella quintana (strain Toulouse)",
            "fullName": "Bartonella quintana (strain Toulouse)"
        },
        "name": "4-hydroxy-3-methylbut-2-enyl diphosphate reductase",
        "description": [
            "Catalyzes the conversion of 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate (HMBPP) into a mixture of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). Acts in the terminal step of the DOXP/MEP pathway for isoprenoid precursor biosynthesis"
        ],
        "length": 340,
        "sequence": "MSVLSPLIIRLCSPRGFCAGVDRAIQIVLLALKKYGAPVYVRHEIVHNRYVVEGLQQRGAIFVEELDEIPEEHRNQPVVFSAHGVPKSVPEQADRYNLFYLDATCPLVSKVHKQAMRHQRHGRHVILIGHAGHPEVIGTMGQLEKGAVTLIETIEDALHYQPDDPDKLGFVTQTTLSVEDTAGILDVLQRRFPALEPPAAESICYATTNRQNAVKAAALGSDLFLIVGAPNSSNSRRLVEVAERFGARQSILVQRADEIDFDRLGPLSVVSLSAGASAPEIIVDEIISAFRERYDVTIELSETVVEMETFLVNRELRNVILTPQDMAFVNGQSETLKNKN",
        "proteome": null,
        "gene": "ispH",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051745",
                "name": "4-hydroxy-3-methylbut-2-enyl diphosphate reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019288",
                "name": "isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050992",
                "name": "dimethylallyl diphosphate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fcbea5256286b22a5f6231f48f5b4e45375830bf",
        "counters": {
            "domain_architectures": 23559,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 2,
                "ncbifam": 2,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 23559
        }
    }
}