General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6F3F3",
        "id": "METK2_ATRNU",
        "source_organism": {
            "taxId": "3553",
            "scientificName": "Atriplex nummularia",
            "fullName": "Atriplex nummularia (Old man saltbush)"
        },
        "name": "S-adenosylmethionine synthase 2",
        "description": [
            "Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate (By similarity). May be involved in the synthesis of betain in response to abiotic stress such as high salinity (PubMed:15695433)"
        ],
        "length": 396,
        "sequence": "MAAAVDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKADVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLSRRPEEIGAGDQGHMFGYASDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLLKGGSRYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA",
        "proteome": null,
        "gene": "SAMS2",
        "go_terms": [
            {
                "identifier": "GO:0004478",
                "name": "methionine adenosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006556",
                "name": "S-adenosylmethionine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "19eaff5c12f42b31629adc7742ec6ffb3fe068a7",
        "counters": {
            "domain_architectures": 35253,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 3,
                "cathgene3d": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35253
        }
    }
}