GET /api/protein/UniProt/Q6DJE3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6DJE3",
"id": "Q6DJE3_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "HMG box domain-containing protein",
"description": [
"Transcription factor that modulates cell fate reprogramming from the somatic state to the pluripotent and neuronal fate. Also acts as a regulatory component of protein phosphatase 1 (PP1) complexes. Component of the PNUTS-PP1 protein phosphatase complex, a PP1 complex that regulates RNA polymerase II transcription pause-release. PNUTS-PP1 also plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase"
],
"length": 465,
"sequence": "MNETNQDFLSANQTYNGQSESNEDYEIPPITPPNMPDPSLLHLVDHESGYHSLCHSLPPNSLIPAYSYQNMDFPAVMVSSMLSQDGHLLSSQLPTIQELVHSEGSSYDHNHQVSLINRSGMLPSHMSALSQSQLVSQMGMRSAITHGSPSPPGSKSATPSPSSSTQEEETESHYKGAGEKRPSTDLGKKPKNQKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSKSYSEQGETKNSQPNQASKIILPKQSMYNLPPQSSSPYPGLASFLSPQDLQSYRAHPHSGLSRTLNAKSMLPSISASPPPPFQISPPLHQHLRHPSSSLLNQSLNMQQVSQPPIMSPSMALHSPMSSSPTGQQDFSHLPSEFQSSVGPRSPTSSNPPGNPEWENEFPNRECGINPCNSLQRDKSLYLT",
"proteome": "UP000186698",
"gene": "tox2.L",
"go_terms": null,
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ba71805ac3750d134530e8b8d14e816f9d4dbece",
"counters": {
"domain_architectures": 54587,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 54587
}
}
}