General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6D6G6",
        "id": "Q6D6G6_PECAS",
        "source_organism": {
            "taxId": "218491",
            "scientificName": "Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)",
            "fullName": "Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)"
        },
        "name": "Flagellar motor switch protein FliM",
        "description": [
            "FliM is one of three proteins (FliG, FliN, FliM) that forms the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation"
        ],
        "length": 337,
        "sequence": "MGDSILSQAEIDALLNGDSGDSDADANAASKTDGGVKPYDPNTQRRVIRERLQALEIINERFARQFRMSLFNLLRRSPDITVGGIKIQPYHEFARNLPVPTNLNLIHLKPLRGTALFVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVVKRMLRLALEAYGEAWNAIYKLDIEYVRSEMQVKFTNITTSPNDIVVTTPFHVEIGSLTGEFNICIPFSMIEPLRELLANPPLENSRQEDQSWRDTLAKQVQHSELELVASFVDIPLRLSKILKLQPGDVLPIDKPDKIVAHVDGVPVLTSQYGTLNGQYALRVEHLINPILNSLDNEEQPHE",
        "proteome": "UP000007966",
        "gene": "fliM",
        "go_terms": [
            {
                "identifier": "GO:0003774",
                "name": "cytoskeletal motor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071973",
                "name": "bacterial-type flagellum-dependent cell motility",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009425",
                "name": "bacterial-type flagellum basal body",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "97807fb7101860eee881408b18586415ca573eb5",
        "counters": {
            "domain_architectures": 10725,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10725
        }
    }
}