GET /api/protein/UniProt/Q68WW7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q68WW7",
"id": "MURG_RICTY",
"source_organism": {
"taxId": "257363",
"scientificName": "Rickettsia typhi (strain ATCC VR-144 / Wilmington)",
"fullName": "Rickettsia typhi (strain ATCC VR-144 / Wilmington)"
},
"name": "UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase",
"description": [
"Cell wall formation. Catalyzes the transfer of a GlcNAc subunit on undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide (lipid intermediate I) to form undecaprenyl-pyrophosphoryl-MurNAc-(pentapeptide)GlcNAc (lipid intermediate II)"
],
"length": 385,
"sequence": "MKKIILVAGGTGGHFFPAVALGEELIKRGYIVHFITDLRCKKYINKDMKIIFYLLDLKRFSNILLFLPTLLIAFLKSIKLIYHIKSCVIIGFGGYPVIAPMFAAIFLRIPIIIHEQNSYLGKVNKFFARFAKKIAISYEDIKNVPEFAKSKIVLTGGIVRKNIRELDSFIYLASQHCPTKLTKTVLTNTLNHFVKARNNKFSNCNIFTLFIFGGSQGAKLFSELIPASIEILMKKQPNLELKIIQQASLAHQVKIKDIYSKLNITYEFAEFFDNIALQYKVANLVISRAGASTIEELTYIGLPTIFIPLPSAADNHQYYNAKLLADNKAGWCLEQNNISAEKLADQILDLISNRQLLEDAAQNLLNRKQEGHLLLSNLIEDTVFL",
"proteome": null,
"gene": "murG",
"go_terms": [
{
"identifier": "GO:0016758",
"name": "hexosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050511",
"name": "undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ac6f850ba17e13ed452f7d29fa33f013cff1199a",
"counters": {
"domain_architectures": 27790,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 27790
}
}
}