HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q68G12",
"id": "SIAT9_RAT",
"source_organism": {
"taxId": "10116",
"scientificName": "Rattus norvegicus",
"fullName": "Rattus norvegicus (Rat)"
},
"name": "Lactosylceramide alpha-2,3-sialyltransferase",
"description": [
"Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose (Gal) of glycosphingolipids forming gangliosides (important molecules involved in the regulation of multiple cellular processes, including cell proliferation and differentiation, apoptosis, embryogenesis, development, and oncogenesis). Mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1), although less preferentially than beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer (LacCer)"
],
"length": 387,
"sequence": "MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH",
"proteome": "UP000002494",
"gene": "St3gal5",
"go_terms": [
{
"identifier": "GO:0008373",
"name": "sialyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009101",
"name": "glycoprotein biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "539ba3211ecb1f85127c965aa98c3308f6899026",
"counters": {
"domain_architectures": 29312,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29312
}
}
}