General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q68FB1",
        "id": "BOD1_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Biorientation of chromosomes in cell division protein 1",
        "description": [
            "Required for proper chromosome biorientation through the detection or correction of syntelic attachments in mitotic spindles"
        ],
        "length": 169,
        "sequence": "MAESGSGAGSGSSSVGGVSNPTSLAPGDSQLIALIVEQLKSRGQFDGFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNADMNKNQLRNGLRQSVIQSGMLEAGVDRIISQVVDPKLNHIFRPQIEKAIQEYLAAQTKEEPAPPLPPGPPEPQEQEPPGPSQSVS",
        "proteome": "UP000008143",
        "gene": "bod1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e29f70b5fb9bccf42964fcc35c5adc12b6c20619",
        "counters": {
            "domain_architectures": 4175,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4175
        }
    }
}