GET /api/protein/UniProt/Q68F18/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q68F18",
"id": "MFN2B_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Mitoferrin-2B",
"description": [
"Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells"
],
"length": 186,
"sequence": "MELEAVLKERTAAAGDPGRVLGAWVRRGWATAGPGVLESDGGSGGTLAFESTSSSRILELTSDNDPEYEALPEGSNVTAHMLAGAVAGVMEHCLMYPVDCVKTRMQSLQPDPAARYRNVMDALSKIVRTEGFWRPLRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNCHVANGIDNSCPA",
"proteome": "UP000186698",
"gene": "slc25a28-b",
"go_terms": null,
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "017758173aee0497f6e27372bc445a063f497ea8",
"counters": {
"domain_architectures": 19163,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19163
}
}
}