General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q67A25",
        "id": "NCS_THLFG",
        "source_organism": {
            "taxId": "150095",
            "scientificName": "Thalictrum flavum subsp. glaucum",
            "fullName": "Thalictrum flavum subsp. glaucum (Yellow meadow rue)"
        },
        "name": "S-norcoclaurine synthase",
        "description": [
            "Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and 4-hydroxyphenylacetaldehyde"
        ],
        "length": 210,
        "sequence": "MMKMEVVFVFLMLLGTINCQKLILTGRPFLHHQGIINQVSTVTKVIHHELEVAASADDIWTVYSWPGLAKHLPDLLPGAFEKLEIIGDGGVGTILDMTFVPGEFPHEYKEKFILVDNEHRLKKVQMIEGGYLDLGVTYYMDTIHVVPTGKDSCVIKSSTEYHVKPEFVKIVEPLITTGPLAAMADAISKLVLEHKSKSNSDEIEAAIITV",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "77fde35ae5b9610746301bf9eabbbe7311c19aa2",
        "counters": {
            "domain_architectures": 15703,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 6,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15703
        }
    }
}