GET /api/protein/UniProt/Q66S61/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q66S61",
        "id": "MBL2_CALJA",
        "source_organism": {
            "taxId": "9483",
            "scientificName": "Callithrix jacchus",
            "fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
        },
        "name": "Mannose-binding protein C",
        "description": [
            "Calcium-dependent lectin, which acts as a pattern recognition receptor that initiates the lectin pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system. Specifically recognizes and binds the mannose moiety of carbohydrates on the pathogen surface, activating the MASP1 serine protease and initiating the proteolytic cascade of the lectin complement pathway"
        ],
        "length": 248,
        "sequence": "MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGAKGQKGDPGASPDCDSSLANPERKTLQTEINRIKKWVTFSLGKQVGKKLFLTNGETMTFDKVKALCAQFQASVATPMNQAENRALQSLVKEEAFLGITDEETEGQFVDLTGRRLTYTNWNKGEPNNADSREDCVVLLRSGGWNDVPCSSSHLVICEFPV",
        "proteome": "UP000008225",
        "gene": "MBL2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b625bbf60511957b4004441b636cccc6a6bd9776",
        "counters": {
            "domain_architectures": 2652,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 1,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2652
        }
    }
}