HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q66NB7",
"id": "EG5A_PHACH",
"source_organism": {
"taxId": "2822231",
"scientificName": "Phanerodontia chrysosporium",
"fullName": "Phanerodontia chrysosporium (White-rot fungus)"
},
"name": "Manganese dependent endoglucanase Eg5A",
"description": [
"Secreted manganese dependent endoglucanase that acts by cleaving the beta-1,4-glucose linkage (PubMed:26173955). Exhibits high activity toward carboxymethyl-cellulose (CMC), barley glucan, and glucomannan (PubMed:26173955). Displays low activity on larminarin and xyloglucan but does not hydrolyze hemicellulose substrates such as birchwood xylan, arabinoxylan, and arabinan (PubMed:26173955)"
],
"length": 386,
"sequence": "MLKYASIALALATLGVAQQQQWGQCGGIGWTGATTCVAGSVCSVLNPYYSQCIPGAATVTSSSAPSTPTPPAGALPRLGGVNTAGYDFSVATDGSFTGTGVSPPVSQFSHFSSQGANLYRIPFAWQLMTPTLGGTISQSFLSRYDQTVQAALNSGPNVFVIIDLHNYARWNGGIIAQGGPTDAQFQSIWTQLAQKYGSNQRVIFGIMNEPHDIPSISTWVNSVQGAVNAIRAAGATNYLLLPGSSWSSAQAFPTEAGPLLVKVTDPLGGTSKLIFDVHKYLDSDNSGTHPDCTTDNVQVLQTLVQFLQANGNRQAILSETGGGNTSSCESLLANELAYVKSAYPTLAGFSVWAAGAFDTTYVLTVTPNADGSDQPLWVDAVKPNLP",
"proteome": null,
"gene": "Eg5A",
"go_terms": [
{
"identifier": "GO:0030248",
"name": "cellulose binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004553",
"name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000272",
"name": "polysaccharide catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "11709f3ade8730af1d8dbb047c651c20b583359f",
"counters": {
"domain_architectures": 1300,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 2,
"smart": 1,
"pfam": 2,
"cathgene3d": 1,
"panther": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1300
}
}
}