General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q66NB7",
        "id": "EG5A_PHACH",
        "source_organism": {
            "taxId": "2822231",
            "scientificName": "Phanerodontia chrysosporium",
            "fullName": "Phanerodontia chrysosporium (White-rot fungus)"
        },
        "name": "Manganese dependent endoglucanase Eg5A",
        "description": [
            "Secreted manganese dependent endoglucanase that acts by cleaving the beta-1,4-glucose linkage (PubMed:26173955). Exhibits high activity toward carboxymethyl-cellulose (CMC), barley glucan, and glucomannan (PubMed:26173955). Displays low activity on larminarin and xyloglucan but does not hydrolyze hemicellulose substrates such as birchwood xylan, arabinoxylan, and arabinan (PubMed:26173955)"
        ],
        "length": 386,
        "sequence": "MLKYASIALALATLGVAQQQQWGQCGGIGWTGATTCVAGSVCSVLNPYYSQCIPGAATVTSSSAPSTPTPPAGALPRLGGVNTAGYDFSVATDGSFTGTGVSPPVSQFSHFSSQGANLYRIPFAWQLMTPTLGGTISQSFLSRYDQTVQAALNSGPNVFVIIDLHNYARWNGGIIAQGGPTDAQFQSIWTQLAQKYGSNQRVIFGIMNEPHDIPSISTWVNSVQGAVNAIRAAGATNYLLLPGSSWSSAQAFPTEAGPLLVKVTDPLGGTSKLIFDVHKYLDSDNSGTHPDCTTDNVQVLQTLVQFLQANGNRQAILSETGGGNTSSCESLLANELAYVKSAYPTLAGFSVWAAGAFDTTYVLTVTPNADGSDQPLWVDAVKPNLP",
        "proteome": null,
        "gene": "Eg5A",
        "go_terms": [
            {
                "identifier": "GO:0030248",
                "name": "cellulose binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000272",
                "name": "polysaccharide catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "11709f3ade8730af1d8dbb047c651c20b583359f",
        "counters": {
            "domain_architectures": 1300,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 2,
                "smart": 1,
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1300
        }
    }
}