General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q66KP4",
        "id": "Q66KP4_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Uroporphyrinogen-III synthase",
        "description": [
            "Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III, the branch point for the various sub-pathways leading to the wide diversity of porphyrins. Porphyrins act as cofactors for a multitude of enzymes that perform a variety of processes within the cell such as methionine synthesis (vitamin B12) or oxygen transport (heme)"
        ],
        "length": 262,
        "sequence": "MKVLLLKDPKTKDLASDPYVKELSSHGLQATLIPVLSFKFVSLDHFFDKLSHPESYAGLIFTSPRAVEAVKLCLQKPAHKEAWKDHLCAKWNSKPVYVVGKATASLVEEIGLSSEGEGSGNAEKLAECICSKGLSYSAPILFPCGSLKKEVLPKKLQEKNVPLETITVYQTGPHPAIQVSLSDYFTKEGVPASIVFFSPSGLKYCLLFLKDLPSDQLNQIKFAAIGPTTAEAMAEEGIPVSCTAQNPTPQDLAIGIKQIGMQ",
        "proteome": "UP000186698",
        "gene": "uros.L",
        "go_terms": [
            {
                "identifier": "GO:0004852",
                "name": "uroporphyrinogen-III synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033014",
                "name": "tetrapyrrole biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006780",
                "name": "uroporphyrinogen III biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8fb265d2a8e7629a163d36589a380c0cdac16a4f",
        "counters": {
            "domain_architectures": 23907,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23907
        }
    }
}