General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q66KC7",
        "id": "Q66KC7_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Exostosin-like 2",
        "description": [
            "Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains"
        ],
        "length": 314,
        "sequence": "MLRMSCVVLVLLLLFLGALTALLPATNEDAVVGVRRGIPLSAVSPKDVFTLIMQTYNRTDLLLKMLNHYQAMPGLSHVIVVWNNVGQDTPQELWESFGPHPVPVTFKKQKVNLMRNRLQSFPEIQTQAVLMMDDDTLVSAYDISFAFSVWQQFPDRIVGFVPRKHVSSPSGIYSYGSFELKAPHTETGDMYSMILIGAAFFHSDYLRLFEQLPASVHNMIDQTQNCDDIAMNFMVANHLGKASGVLVKPTDMRNLEKEAGSGYTGMWHRAEHLLQRSFCLNKLAEIYSTMPLKYSSIMISQFGFPNYANHKSKI",
        "proteome": "UP000008143",
        "gene": "extl2",
        "go_terms": [
            {
                "identifier": "GO:0016757",
                "name": "glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f9d711e9cd4fcd4c9952db66f4dfe4eaed614778",
        "counters": {
            "domain_architectures": 3871,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3871
        }
    }
}