GET /api/protein/UniProt/Q641F1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q641F1",
        "id": "UBCP1_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Ubiquitin-like domain-containing CTD phosphatase 1",
        "description": [
            "Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. Recruited to the 19S regulatory particle of the 26S proteasome where it dephosphorylates 19S component psmc2 which impairs psmc2 ATPase activity and disrupts 26S proteasome assembly. Has also been reported to stimulate the proteolytic activity of the 26S proteasome"
        ],
        "length": 318,
        "sequence": "MTLSLIIKWGGQEFPLSALSEEDTVLDLKHSLKSLTGVLPERMKLLGLKYKGKPAENDVKLGVLRLKPNTKIMMMGTREESLEEMMAPPPDNDEVVNDFDIDEEVVEVENREENLAKISRRVKDYKVEVLNPPREGKKLLVLDVDYTLFDHRSCAETGQELMRPYLHEFLSSAYEDYDIVIWSATSMKWIEAKMKELGVTTNANYKITFMLDSAAMITVHTPRRGLVDVKPLGVIWGKYGEFYSKNNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELVKLSQYLKEIAQLDDLSELNHKHWERYLAKKQGQ",
        "proteome": "UP000186698",
        "gene": "ublcp1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0090364",
                "name": "regulation of proteasome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004721",
                "name": "phosphoprotein phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "18bade6d39c91fe8b4a16602da56d0e484bca407",
        "counters": {
            "domain_architectures": 1857,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "smart": 2,
                "profile": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1857
        }
    }
}