GET /api/protein/UniProt/Q639M2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q639M2",
"id": "PXPA_BACCZ",
"source_organism": {
"taxId": "288681",
"scientificName": "Bacillus cereus (strain ZK / E33L)",
"fullName": "Bacillus cereus (strain ZK / E33L)"
},
"name": "5-oxoprolinase subunit A",
"description": [
"Catalyzes the cleavage of 5-oxoproline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate"
],
"length": 253,
"sequence": "MTTIDLNCDLGESFGAYKMGNDDEILPFVSSINVACGFHAGDPSVMRQTVEKAMQHNVAIGAHPGFPDLIGFGRRNMNVSASEVYDYVLYQIGALDTFVKAAGGKMHHVKPHGALYNMAATNPEIADAIAKAIYHSNPSLLFYGLANSEAFIQAAEKYNITLVQEAFADRTYKQDGTLTSRTEENALIKNEEEAIKQVLQMVKEGYVNSVNGEKVAVQAQTICLHGDGEKAVQFARRIYRTFENNEISICTPK",
"proteome": null,
"gene": "pxpA",
"go_terms": [
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5d844f330deb244f4bc086530ce54276f2d0f668",
"counters": {
"domain_architectures": 17789,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 3,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17789
}
}
}