General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q62361",
        "id": "TRH_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Pro-thyrotropin-releasing hormone",
        "description": [
            "Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems"
        ],
        "length": 256,
        "sequence": "MQGPWLMMALALIFVLTGIPKSCALLEAAQEEGAVTPDLPGLEKVQVRPERRFLRKDLQRVRGDLGAALDSWITKRQHPGKREEKEEDVEAEERGDLGEVGAWRPHKRQHPGRRANQDKDSWSDEGDSDWLPPSWLPDFFLDSWFSDAPQVKRQHPGRRSFPWMESDVTKRQHPGRRFIDPELQRSWEETEGEEGGLMPEKRQHPGKRAVGHPCGPQGICGQTGLLQLLGDLSRGQETLAKQTPQLEAWVREPLEE",
        "proteome": "UP000000589",
        "gene": "Trh",
        "go_terms": [
            {
                "identifier": "GO:0008437",
                "name": "thyrotropin-releasing hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009755",
                "name": "hormone-mediated signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7ce8820c6f1f1d6248a3d52473868879f9668a36",
        "counters": {
            "domain_architectures": 45,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 45
        }
    }
}