General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q607G9",
        "id": "Q607G9_METCA",
        "source_organism": {
            "taxId": "243233",
            "scientificName": "Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)",
            "fullName": "Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)"
        },
        "name": "Aspartate/glutamate leucyltransferase",
        "description": [
            "Functions in the N-end rule pathway of protein degradation where it conjugates Leu from its aminoacyl-tRNA to the N-termini of proteins containing an N-terminal aspartate or glutamate"
        ],
        "length": 233,
        "sequence": "MGPNHPCGYLPGRDARFTYVSPAYPLSPQSYRGLLEEGFRRSGNWVYRPCCIGCSACLPVRLPVHDFRLTRSHRRVIKRNADIDIRVSVARFDERQFQLYVRYLAARHPTDTPVSRDDYWSFVSSSWAQTRFVEFRSYSELIGVAVVDHVPGALSAVYTFFDPDAAERSPGSLAILWQILEARRLGREWLYLGYWIGGCRKMEYKARYRPLEALIANRWRRFQVDEPLTSSVL",
        "proteome": null,
        "gene": "bpt",
        "go_terms": [
            {
                "identifier": "GO:0008914",
                "name": "leucyl-tRNA--protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071596",
                "name": "ubiquitin-dependent protein catabolic process via the N-end rule pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004057",
                "name": "arginyl-tRNA--protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016598",
                "name": "protein arginylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "79c7d9d88ddd90ba9af65e143af6660af705c356",
        "counters": {
            "domain_architectures": 12521,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 3,
                "pirsf": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12521
        }
    }
}