GET /api/protein/UniProt/Q606Z6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q606Z6",
"id": "Q606Z6_METCA",
"source_organism": {
"taxId": "243233",
"scientificName": "Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)",
"fullName": "Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)"
},
"name": "Riboflavin synthase",
"description": [
"Catalyzes the dismutation of two molecules of 6,7-dimethyl-8-ribityllumazine, resulting in the formation of riboflavin and 5-amino-6-(D-ribitylamino)uracil"
],
"length": 218,
"sequence": "MFTGIIRGRGLIVAADPQDTGTRFRIRFPDDLLGGLETGASVAVDGVCLTVVRIAGNEIDFDVVAGTLALTNLGDRRVGDEVNLERSARLGDEVGGHHVSGHVSTTGVLTSVELEGSGSHHIEFQVDPEWTRYIFLRGFLAVDGASLTVAEADSERGRFRINLIPETLRNTCFRRYRVGDRVNIEVEHQTQVLVDVVTRTISAALAGRETVGPRNASP",
"proteome": null,
"gene": "ribE-2",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a727a82b8b181c1f06f3b9bef8a4fc9601f2b055",
"counters": {
"domain_architectures": 26174,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 3,
"panther": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26174
}
}
}