GET /api/protein/UniProt/Q606Z6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q606Z6",
        "id": "Q606Z6_METCA",
        "source_organism": {
            "taxId": "243233",
            "scientificName": "Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)",
            "fullName": "Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)"
        },
        "name": "Riboflavin synthase",
        "description": [
            "Catalyzes the dismutation of two molecules of 6,7-dimethyl-8-ribityllumazine, resulting in the formation of riboflavin and 5-amino-6-(D-ribitylamino)uracil"
        ],
        "length": 218,
        "sequence": "MFTGIIRGRGLIVAADPQDTGTRFRIRFPDDLLGGLETGASVAVDGVCLTVVRIAGNEIDFDVVAGTLALTNLGDRRVGDEVNLERSARLGDEVGGHHVSGHVSTTGVLTSVELEGSGSHHIEFQVDPEWTRYIFLRGFLAVDGASLTVAEADSERGRFRINLIPETLRNTCFRRYRVGDRVNIEVEHQTQVLVDVVTRTISAALAGRETVGPRNASP",
        "proteome": null,
        "gene": "ribE-2",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a727a82b8b181c1f06f3b9bef8a4fc9601f2b055",
        "counters": {
            "domain_architectures": 26174,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 3,
                "panther": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26174
        }
    }
}