GET /api/protein/UniProt/Q5ZUF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5ZUF4",
        "id": "DTD_LEGPH",
        "source_organism": {
            "taxId": "272624",
            "scientificName": "Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)",
            "fullName": "Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)"
        },
        "name": "D-aminoacyl-tRNA deacylase",
        "description": [
            "An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality"
        ],
        "length": 145,
        "sequence": "MLTVLQRVKEARVDIDGQTVGKINHGLLILCGFEPKDSLENIKRMLDKCINYRIFEDPSGKMNLSLKDVNGGLLLVPQFTLMADTQKGLRPSFSNAASPELGRELFDNLLTLAQKCHQNTQSGCFGANMQVYLCNDGPVTFLLQF",
        "proteome": "UP000000609",
        "gene": "dtd",
        "go_terms": [
            {
                "identifier": "GO:0002161",
                "name": "aminoacyl-tRNA deacylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051499",
                "name": "D-aminoacyl-tRNA deacylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f5be7e64ef081c09c5a2f79246df4a2ddc956ba1",
        "counters": {
            "domain_architectures": 25258,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25258
        }
    }
}