General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5ZF42",
        "id": "Q5ZF42_CERV",
        "source_organism": {
            "taxId": "10640",
            "scientificName": "Carnation etched ring virus",
            "fullName": "Carnation etched ring virus (CERV)"
        },
        "name": "Movement protein",
        "description": [
            "Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming tubules structures that increase the size exclusion limit (SEL) of plasmodesmata, thereby allowing viral ribonucleocapsids to spread directly to neighboring cells"
        ],
        "length": 319,
        "sequence": "MNSSIEKQNSEIPEKENEEFTFQDNSQGFELEFSTNKKTLSKIQKANLSLKTNDAFNISFLKAFSRKNHIYYHVNYKEFSVDICDTHGKNYLPLVTKSEIKKNLDKIRDEKVRSTISDIHFGAIKVLIKARFREGINSPIKMALIDDRITDRQDSILGAAHGNLVYGKFMFTVYPKYTTSILDQRLDRTLAFIHHFERNDLMRKGDKVFSITYLVAYALANSHHSIDYKEKDAIEIDDVFSEIGSVKSPTFTELDPEPNSWAIDIAQGKQPIGFKPKPIVSNNFLRFDKETSPSSSHQKSLEEISDKIDTLVVKLNNIS",
        "proteome": null,
        "gene": "MP",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "76ceb4b9c5197d7c534c142d15d59e2538c77303",
        "counters": {
            "domain_architectures": 4219,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4219
        }
    }
}