GET /api/protein/UniProt/Q5Z9P6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5Z9P6",
        "id": "Q5Z9P6_ORYSJ",
        "source_organism": {
            "taxId": "39947",
            "scientificName": "Oryza sativa subsp. japonica",
            "fullName": "Oryza sativa subsp. japonica (Rice)"
        },
        "name": "Translocon-associated protein subunit alpha",
        "description": [
            "TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins"
        ],
        "length": 257,
        "sequence": "MAATRVWLSALLLAFLLAAAPVVQVARAQSMEEAATAEVVDGADLGIVSDDTQVSSDGPLSPAPGVETVCVFPKNAGKIVLAGEETELLVGLQNEGESTLNVVAIHSTLHLPFDHKMYGQNLTVQNFFNASVPVSVQATFPYTFAVSKFLQPGAYDLVGYIVYEIDQNPYQNVFYNGTVEVVEAGGLLSVESVFLITLGVALLGLFGLWAYGQVQQLSKKTKKAPKVELGTGTTDANMDEWLEGTAFAQGSKSKKKK",
        "proteome": "UP000059680",
        "gene": "Os06g0715500",
        "go_terms": [
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73b3e38fa3b13a6a5e7ca9455daef582b387fe50",
        "counters": {
            "domain_architectures": 5577,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5577
        }
    }
}