General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5XGC7",
        "id": "CALL4_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Calmodulin-like protein 4",
        "description": [
            "As part of the intermicrovillar adhesion complex/IMAC plays a role in epithelial brush border differentiation, controlling microvilli organization and length. Acts as a light chain for MYO7B and is required for efficient targeting of the IMAC to the tips of border brush microvilli"
        ],
        "length": 153,
        "sequence": "MAKFLSQDAIQKFKECFSLYDKKGKGKIPAGDLLTVMRCLGTCPTPGEVTRHLQVHKIGKDGEVDFSTFLTIMYRQQKQEDPENEIMVAMLMSDKQKKGVIPLKELRAKLTQMGEKLTPEEVDDLLKGVKVGPDGMVKYEEFVRQITLPVPDY",
        "proteome": "UP000008143",
        "gene": "calml4",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "727f1dafe35089f5252a4c37c304932ae6470d52",
        "counters": {
            "domain_architectures": 6700,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6700
        }
    }
}