General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5U573",
        "id": "Q5U573_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Dual specificity protein phosphatase 23",
        "description": [
            "Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14)"
        ],
        "length": 151,
        "sequence": "MPPVPPHNFSWVEPGLLAGMAMPRLPAHYEYLYENGIRHLITLTEHKPPYHDTCPGITLHRIRIQDFCAPSLEQIKNFLKIVDDAKSKGEAVGVHCLHGFGRTGTMLACYLVKVRKITGVDAINEIRCLRRGSIETNEQEKAIIQFHHHIK",
        "proteome": "UP000186698",
        "gene": "dusp23.L",
        "go_terms": [
            {
                "identifier": "GO:0006470",
                "name": "protein dephosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016311",
                "name": "dephosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7a210c1284e30746670eca586c3dfe0fd377ded7",
        "counters": {
            "domain_architectures": 5770,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 2,
                "profile": 2,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5770
        }
    }
}