General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5SHP2",
        "id": "RS19_THET8",
        "source_organism": {
            "taxId": "300852",
            "scientificName": "Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)",
            "fullName": "Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)"
        },
        "name": "Small ribosomal subunit protein uS19",
        "description": [
            "Located at the top of the head of the 30S subunit, extending towards the 50S subunit, which it may contact in the 70S complex. Contacts several RNA helices of the 16S rRNA"
        ],
        "length": 93,
        "sequence": "MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK",
        "proteome": "UP000000532",
        "gene": "rpsS",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8102f30e9f63f37ede7882f240b268854d5a4596",
        "counters": {
            "domain_architectures": 50002,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 410,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 50002
        }
    }
}