HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5SDS1",
"id": "Q5SDS1_SALSA",
"source_organism": {
"taxId": "8030",
"scientificName": "Salmo salar",
"fullName": "Salmo salar (Atlantic salmon)"
},
"name": "Growth hormone 1",
"description": [
"Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation"
],
"length": 210,
"sequence": "MGQVFLLMPVLLVSCFLSQGAAMENQRLFNIAVNRVQHLHLMAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKLETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIKGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL",
"proteome": "UP001652741",
"gene": "LOC100136588",
"go_terms": [
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005131",
"name": "growth hormone receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005615",
"name": "extracellular space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d466c05a6c5d2269669bb799ef8b087ee7e11dac",
"counters": {
"domain_architectures": 5872,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5872
}
}
}