GET /api/protein/UniProt/Q5RDB4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5RDB4",
"id": "NEMP1_PONAB",
"source_organism": {
"taxId": "9601",
"scientificName": "Pongo abelii",
"fullName": "Pongo abelii (Sumatran orangutan)"
},
"name": "Nuclear envelope integral membrane protein 1",
"description": [
"Together with EMD, contributes to nuclear envelope stiffness in germ cells (By similarity). Required for female fertility (By similarity). Essential for normal erythropoiesis (By similarity). Required for efficient nuclear envelope opening and enucleation during the late stages of erythroblast maturation (By similarity)"
],
"length": 444,
"sequence": "MAGGMKVAVSPAVGPGPWGSGVGGGGTVRLLLILSGCLVYGTAEIDVNVVMLQESQVCEKRASQQFCYTNVLIPKWHDIWTRIQIRVNSSKLVRVTQVENEQKLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLLSRSQIFYYSTGMSVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLSYILTVGFMSFAVCYKYGPLENERSIDLLTWTLQLMGLCFMYSGIQIPHIALAIIIIALCTKNLEYPIQWLYITYRKVCKAAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNFLT",
"proteome": "UP000001595",
"gene": "NEMP1",
"go_terms": null,
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b5c39df1e9158b1ddef98f94a6c3932858078e49",
"counters": {
"domain_architectures": 4087,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4087
}
}
}