GET /api/protein/UniProt/Q5QA79/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5QA79",
"id": "PETG_ACOGR",
"source_organism": {
"taxId": "55184",
"scientificName": "Acorus gramineus",
"fullName": "Acorus gramineus (Dwarf sweet flag)"
},
"name": "Cytochrome b6-f complex subunit 5",
"description": [
"Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex"
],
"length": 37,
"sequence": "MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL",
"proteome": null,
"gene": "petG",
"go_terms": [
{
"identifier": "GO:0009512",
"name": "cytochrome b6f complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e883d695708255d85919c062f74378f12f3249e6",
"counters": {
"domain_architectures": 13580,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"ncbifam": 1,
"pirsf": 1,
"pfam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13580
}
}
}