HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5PGG9",
"id": "IHFB_SALPA",
"source_organism": {
"taxId": "295319",
"scientificName": "Salmonella paratyphi A (strain ATCC 9150 / SARB42)",
"fullName": "Salmonella paratyphi A (strain ATCC 9150 / SARB42)"
},
"name": "Integration host factor subunit beta",
"description": [
"This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control"
],
"length": 94,
"sequence": "MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG",
"proteome": null,
"gene": "ihfB",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030527",
"name": "structural constituent of chromatin",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006310",
"name": "DNA recombination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005694",
"name": "chromosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "69cfcabeafc3186618e3c95978399e9c6cf3360d",
"counters": {
"domain_architectures": 61377,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 61377
}
}
}