General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5M1I1",
        "id": "XERDL_STRT1",
        "source_organism": {
            "taxId": "299768",
            "scientificName": "Streptococcus thermophilus (strain CNRZ 1066)",
            "fullName": "Streptococcus thermophilus (strain CNRZ 1066)"
        },
        "name": "Tyrosine recombinase XerD-like",
        "description": [
            "Putative tyrosine recombinase. Not involved in the cutting and rejoining of the recombining DNA molecules on dif(SL) site"
        ],
        "length": 253,
        "sequence": "MTISSFQKQLTTQITNFLARKTISDSSKQAYAYDLKQFVNCLPGRVDQTSLKLYENQLKEWKPSVQKRKRSAVNQFLLYLYQKGELEEFFKLSETAPLPSQQEELEIFDLSSLYEGQEGPGKLACLFILELGLLPSEILELKWEDIDLDFGVVTVAKGSTKRVLRLDGALKELLFGIKNDNSQGLILSKAFTRQWLYKQIQSYVGGCGLSGVTAQALRQQYILRQIEKGTGAFELARLLGLKSPVTLEKYYKT",
        "proteome": null,
        "gene": "str0259",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015074",
                "name": "DNA integration",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "91bb1cb977840a07c5cfbf918b1f9f09c4c9d151",
        "counters": {
            "domain_architectures": 107326,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 107326
        }
    }
}