General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5L2V9",
        "id": "SELO_GEOKA",
        "source_organism": {
            "taxId": "235909",
            "scientificName": "Geobacillus kaustophilus (strain HTA426)",
            "fullName": "Geobacillus kaustophilus (strain HTA426)"
        },
        "name": "Protein nucleotidyltransferase YdiU",
        "description": [
            "Nucleotidyltransferase involved in the post-translational modification of proteins. It can catalyze the addition of adenosine monophosphate (AMP) or uridine monophosphate (UMP) to a protein, resulting in modifications known as AMPylation and UMPylation"
        ],
        "length": 484,
        "sequence": "MDAGWKFDNSYARLPERFFSKVLPTPVRAPKLAVLNRSLAVKLGLNEEALRSEDGVAVFGGNQIPGGAEPLAQAYAGHQFGYFTMLGDGRAVLLGEHVTPSGERVDIQLKGSGRTPYSRGGDGRAALGPMLREYIVSEAMHALGIPTTRSLAVVTTGETIMRETELPGAVLTRVASSHLRVGTFQYAAQWGTIEELRALADYALWRHFPGFEEAENRYLFLLEQVIERQAELIAKWQLVGFVHGVMNTDNMTISGETIDYGPCAFMDTYSLETVFSSIDTEGRYAYGNQPYIGGWNLARFAESLLPLLDENEEKAIALAQGALDEYPKRYHHHWLSGMRAKLGLAEEQEGDQELIADLLRLMEAHRADYTNTFRALTLGEYTGMALFDSAEFREWQERWQTRLSQESVSREEAYERMRRHNPAVIPRNHRVEEALAAAVHDGDYSVMERFLEALSDPYAYSPEQEKYAELPPPSDRPYRTFCGT",
        "proteome": "UP000001172",
        "gene": "ydiU",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "639a5ea9a0d2f1ce3741370e01c639006debb12b",
        "counters": {
            "domain_architectures": 19179,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19179
        }
    }
}