GET /api/protein/UniProt/Q5IAM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5IAM8",
        "id": "Q5IAM8_9AVES",
        "source_organism": {
            "taxId": "304659",
            "scientificName": "Myrtis fanny",
            "fullName": "Myrtis fanny"
        },
        "name": "NADH-ubiquinone oxidoreductase chain 2",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I"
        ],
        "length": 346,
        "sequence": "MNPYAKLTFSLSLTLGTTITISSSHWMSAWAGLEINTLAIIPLISKSHHPRAIEAAIKYFLVQAAASTLLLFSSMINAWHTGQWDITQLNHPTSCLLLSTAIAMKLGLVPFHFWFPEVLQGSPLTTAMLLSTVMKFPPMTILFLTSHSLNPTLLTTMALASAALGGWMGLNQTQTRKILAFSSISHLGWMTIILIYNPKLTLMTFYLYCIMTSAIFLTLNTTKSLKLSTMMTSWTKTPVLNTTLMMTLLSLAGLPPLTGFLPKWLIIQELSKQEMAASAVIIAILSLLGLFFYLRLAYYSTITLPPNPTNHMKQWHTNKPTSTLIAALSSLSTLLLPLSPMVLASI",
        "proteome": null,
        "gene": "ND2",
        "go_terms": [
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006120",
                "name": "mitochondrial electron transport, NADH to ubiquinone",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c066dd8c9053ff8f269252858f5fce0f0fa244db",
        "counters": {
            "domain_architectures": 68447,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 68447
        }
    }
}