General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5HFJ8",
        "id": "DNAG_STAAC",
        "source_organism": {
            "taxId": "93062",
            "scientificName": "Staphylococcus aureus (strain COL)",
            "fullName": "Staphylococcus aureus (strain COL)"
        },
        "name": "DNA primase",
        "description": [
            "RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication"
        ],
        "length": 599,
        "sequence": "MRIDQSIINEIKDKTDILDLVSEYVKLEKRGRNYIGLCPFHDEKTPSFTVSEDKQICHCFGCKKGGNVFQFTQEIKDISFVEAVKELGDRVNVAVDIEATQSNSNVQIASDDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERGFTDALIKERGIGFAPDSSHFCHDFLQKKGYDIELAYEAGLLSRNEENFSYYDRFRNRIMFPLKNAQGRIVGYSGRTYTGQEPKYLNSPETPIFQKRKLLYNLDKARKSIRKLDEIVLLEGFMDVIKSDTAGLKNVVATMGTQLSDEHITFIRKLTSNITLMFDGDFAGSEATLKTGQNLLQQGLNVFVIQLPSGMDPDEYIGKYGNDAFTAFVKNDKKSFAHYKVSILKDEIAHNDLSYERYLKELSHDISLMKSSILQQKALNDVAPFFNVSPEQLANEIQFNQAPANYYPEDEYGGYIEPEPIGMAQFDNLSRQEKAERAFLKHLMRDKDTFLNYYESVDKDNFTNQHFKYVFEVLHDFYAENDQYNISDAVQYVNSNELRETLISLEQYNLNDEPYENEIDDYVNVINEKGQETIESLNHKLREATRIGDVELQKYYLQQIVAKNKERM",
        "proteome": null,
        "gene": "dnaG",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003899",
                "name": "DNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003678",
                "name": "DNA helicase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006269",
                "name": "DNA replication, synthesis of primer",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4a2186f4017c0b552f6c60e16df9c3a3f7ef7523",
        "counters": {
            "domain_architectures": 96,
            "entries": 32,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 3,
                "cathgene3d": 5,
                "pfam": 4,
                "smart": 2,
                "cdd": 1,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 12
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 96
        }
    }
}