General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5FNB7",
        "id": "MSCL_GLUOX",
        "source_organism": {
            "taxId": "290633",
            "scientificName": "Gluconobacter oxydans (strain 621H)",
            "fullName": "Gluconobacter oxydans (strain 621H)"
        },
        "name": "Large-conductance mechanosensitive channel",
        "description": [
            "Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell"
        ],
        "length": 152,
        "sequence": "MSETKHTLHTPGWVSDFQKFIMRGNVLDLAVGVVIGAAFSAIVGSAVKDILTPFIGLITGGVDFSNLFITLKGPVKDTLAEAQKAGAVTVNIGVFLNAVIQFLIIAFFIFWLTRILSKLSRKQEAAPAAPPAPTKEEVLLTEIRDLLAQKNS",
        "proteome": "UP000006375",
        "gene": "mscL",
        "go_terms": [
            {
                "identifier": "GO:0008381",
                "name": "mechanosensitive monoatomic ion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034220",
                "name": "monoatomic ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6f99e8018eaa5607dc65dc2829aed0b45775c497",
        "counters": {
            "domain_architectures": 21782,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 3,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21782
        }
    }
}