General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5EAY1",
        "id": "Q5EAY1_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "DnaJ homolog subfamily C member 9",
        "description": [
            "Acts as a dual histone chaperone and heat shock co-chaperone. As a histone chaperone, forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers; and may thereby assist MCM2 in histone H3-H4 heterodimer recognition and facilitate the assembly of histones into nucleosomes. May also act as a histone co-chaperone together with TONSL. May recruit histone chaperones ASF1A, NASP and SPT2 to histone H3-H4 heterodimers. Also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins, such as HSPA1A, HSPA1B and HSPA8. As a co-chaperone, may play a role in the recruitment of HSP70-type molecular chaperone machinery to histone H3-H4 substrates, thereby maintaining the histone structural integrity. Exhibits activity to assemble histones onto DNA in vitro"
        ],
        "length": 262,
        "sequence": "MPGLLESCERHFGTSDLYKVLGVRKEAGEGEIRRGYHRVSLKVHPDRVQDGEKETATAEFQILGKVYAVLSDKEQRALYDEQGIVDEETDTLSQDRNWEEYWRLLFKKITVEDIKAYEEKYKGSEEEKNDIISAYMDFEGDLDGIMESVPCADFEDEPRIRQIIQKAIKSKEIPSYDTFVKETKKKREQRKKRAHEEAKEAEEMKKEMGLGDDNDDLKALIQKRQNDRKKEMDGFFDQLEAKYCSNSKKAPSKSKAPKRGKK",
        "proteome": "UP000186698",
        "gene": "dnajc9.L",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f884952723454f9b46b58c9d9a58468e2a30d78b",
        "counters": {
            "domain_architectures": 4003,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 2,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4003
        }
    }
}