GET /api/protein/UniProt/Q5E2A6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5E2A6",
        "id": "Q5E2A6_ALIF1",
        "source_organism": {
            "taxId": "312309",
            "scientificName": "Aliivibrio fischeri (strain ATCC 700601 / ES114)",
            "fullName": "Aliivibrio fischeri (strain ATCC 700601 / ES114)"
        },
        "name": "tRNA (cytidine(34)-2'-O)-methyltransferase",
        "description": [
            "Methylates the ribose at the nucleotide 34 wobble position in the two leucyl isoacceptors tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). Catalyzes the methyl transfer from S-adenosyl-L-methionine to the 2'-OH of the wobble nucleotide"
        ],
        "length": 159,
        "sequence": "MFDIALYEPEIAPNTGNIIRLSANCGANLHLIEPLGFDLEEKKLRRAGLDYHDLAHVKRHKNYAAFLEYLANDSDVEHRIFACTTKTTGHHTTPTYQKGDVLLFGPETRGLPADLIDGLPMEQRVRIPMMPDSRSLNLSNSVAIIVFEAWRQMGFEGGL",
        "proteome": "UP000000537",
        "gene": "yibK",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001510",
                "name": "RNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008173",
                "name": "RNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1f4922ed6291786582caadede6a092d9f64a556b",
        "counters": {
            "domain_architectures": 60928,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 60928
        }
    }
}