HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5D0W8",
"id": "NPR1_ORYSI",
"source_organism": {
"taxId": "39946",
"scientificName": "Oryza sativa subsp. indica",
"fullName": "Oryza sativa subsp. indica (Rice)"
},
"name": "BTB/POZ domain and ankyrin repeat-containing protein NPR1",
"description": [
"Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Transcription cofactor that represses gene expression in the absence of salicylic acid (SA), when attached to negative cis-elements (W-box) with WRKY transcription factors, but stimulates gene expression upon activation by SA, when sumoylated and attached to positive cis-elements (as-1) with TGA transcription factors, thus confering immunity through a series of gene regulations ending in a significant increase in antimicrobial and defense genes expression (By similarity). Key positive factor of disease resistance (PubMed:15986920, Ref.2). Involved in defense response against the bacterial blight disease caused by Xanthomonas oryzae pv. oryzae (Xoo). Plants over-expressing NPR1/NH1 acquire high levels of resistance to Xoo, express constitutively defense genes and develop lesion-mimic spots on leaves at pre-flowering stage (PubMed:15986920). Involved in basal resistance to the blast pathogen Magnaporthe oryzae. Plants over-expressing NPR1/NH1 have increased resistance to M.oryzae infection (Ref.2). Plays an essential role in benzothiadiazole (BTH)-induced resistance to the blast fungus disease caused by Magnaporthe oryzae (By similarity). Functions as a transcriptional coactivator of TGA2.1 and LG2 in vitro (By similarity). Involved in defense response against herbivore. Plants silencing NPR1/NH1 have increased herbivore-induced trypsin proteinase inhibitors and volatiles, which reduces the performance of the striped stem borer (SSB) Chilo suppressalis (By similarity)"
],
"length": 582,
"sequence": "MEPPTSHVTNAFSDSDSASVEEGDADADADVEALRRLSDNLAAAFRSPEDFAFLADARIAVPGGGGGGGDLRVHRCVLSARSPFLRGVFARRAAAAAGGGGEDGSERLELRELLGGGGEEVEVGYEALRLVLDYLYSGRVGDLPKAACLCVDEDCAHVGCHPAVAFMAQVLFAASTFQVAELTNLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMKLLERCLDMVVRSNLDMITLEKSLPPDVIKQIIDARLSLGLISPENKGFPNKHVRRIHRALDSDDVELVRMLLTEGQTNLDDAFALHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAARRREPKIIVSLLTKGARPADVTFDGRKAVQISKRLTKQGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLAMAGESLRGRLLYLENRVALARIMFPMEARVAMDIAQVDGTLEFNLGSGANPPPERQRTTVDLNESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKRKRFHDLQDVLQKAFHEDKEENDRSGLSSSSSSTSIGAIRPRR",
"proteome": "UP000007015",
"gene": "NPR1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009862",
"name": "systemic acquired resistance, salicylic acid mediated signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:2000022",
"name": "regulation of jasmonic acid mediated signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:2000031",
"name": "regulation of salicylic acid mediated signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "198888b04662b31a5457d1d9ee24826c5a022078",
"counters": {
"domain_architectures": 35,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 2,
"profile": 4,
"smart": 2,
"pfam": 2,
"panther": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 35
}
}
}
