General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5BKV7",
        "id": "Q5BKV7_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Cysteine-rich protein 1",
        "description": [
            "Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein"
        ],
        "length": 77,
        "sequence": "MPKCPKCQKEVYFAERVTSLGKDWHRPCLKCEKCNKTLSAGSHAEHEGKPYCNNPCYAALFGPKGFGRGGTESHTFK",
        "proteome": "UP000000437",
        "gene": "crip1",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fc4ada7dd557124d577a31fe95a47a3d2be0cdf2",
        "counters": {
            "domain_architectures": 15865,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15865
        }
    }
}