GET /api/protein/UniProt/Q5AEB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q5AEB8",
        "id": "Q5AEB8_CANAL",
        "source_organism": {
            "taxId": "237561",
            "scientificName": "Candida albicans (strain SC5314 / ATCC MYA-2876)",
            "fullName": "Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)"
        },
        "name": "Proteasome subunit alpha type",
        "description": [
            "The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity"
        ],
        "length": 251,
        "sequence": "MSRRYDSRTTIFSPEGRLYQVEYAQEAISNAGTAIGILSPEGVVLACEKKVTSKLLDDDGSAEKLYIINDQMICAVAGMTADASILVNNARIQAQQYLKLYDEEIPCEMLINRVCDVKQGYTQHGGLRPFGVSFLYAGYDDRYQFQLFTSNPSGNYSGWKATSIGANNSAAQTLLKKDYKDDLTLKDACELAIKVLSKTMDASNINSEKLEFATLSLGKDNKVLHKIWNDKDIDILIKASGVLNEKNSDDE",
        "proteome": "UP000000559",
        "gene": "PRE9",
        "go_terms": [
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019773",
                "name": "proteasome core complex, alpha-subunit complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005839",
                "name": "proteasome core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b4fc3eb7060592e47b710df6e92c52ef7477efb8",
        "counters": {
            "domain_architectures": 29684,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29684
        }
    }
}