General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q57IN1",
        "id": "Q57IN1_SALCH",
        "source_organism": {
            "taxId": "321314",
            "scientificName": "Salmonella choleraesuis (strain SC-B67)",
            "fullName": "Salmonella choleraesuis (strain SC-B67)"
        },
        "name": "Ribosomal RNA large subunit methyltransferase J",
        "description": [
            "Specifically methylates the adenine in position 2030 of 23S rRNA"
        ],
        "length": 280,
        "sequence": "MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEPYISVVKHFNRSGQLRYYPGSPLIARQLLREQDSLQLTELHPSDFPLLRAEFQKDNRARVERADGYQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGISEGYKRFATGTYALWYPVVLRQQIKRMIHELEATGIRKILQIELAIRPDSDQRGMTASGMIVVNPPWKLEQQMNNVLPWLHSRLAPNGHGHTSVSWIVPE",
        "proteome": null,
        "gene": "yhiR",
        "go_terms": [
            {
                "identifier": "GO:0008649",
                "name": "rRNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070475",
                "name": "rRNA base methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0032259",
                "name": "methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "120c915e721f3a5de0edf7f5eb1aab1fbae0a36e",
        "counters": {
            "domain_architectures": 8565,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8565
        }
    }
}