GET /api/protein/UniProt/Q57615/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "Q57615",
"id": "PTR1_METJA",
"source_organism": {
"taxId": "243232",
"scientificName": "Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)",
"fullName": "Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)"
},
"name": "HTH-type transcriptional regulator Ptr1",
"description": [
"Participates in positive as well as negative regulation of transcription. Binds to its own promoter"
],
"length": 148,
"sequence": "MLDRIDLKILRILNGNARKSFREIGRELGISEGTVRNRVKRLTEKGIITGFHASINPKNLGFEVVAILGLYIKPSKVEETLNKLKELDEIVELYQTTGEYDAVCIAILKDIESLGKFLAEKIYPLVNVNGCKVTLVLRTFKDGSKMPI",
"proteome": "UP000000805",
"gene": "ptr1",
"go_terms": [
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "edbc5e38b9170f29926e2b4208a8b2fab4997216",
"counters": {
"domain_architectures": 71799,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"profile": 1,
"smart": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 71799
}
}
}