GET /api/protein/UniProt/Q57615/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "Q57615",
        "id": "PTR1_METJA",
        "source_organism": {
            "taxId": "243232",
            "scientificName": "Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)",
            "fullName": "Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)"
        },
        "name": "HTH-type transcriptional regulator Ptr1",
        "description": [
            "Participates in positive as well as negative regulation of transcription. Binds to its own promoter"
        ],
        "length": 148,
        "sequence": "MLDRIDLKILRILNGNARKSFREIGRELGISEGTVRNRVKRLTEKGIITGFHASINPKNLGFEVVAILGLYIKPSKVEETLNKLKELDEIVELYQTTGEYDAVCIAILKDIESLGKFLAEKIYPLVNVNGCKVTLVLRTFKDGSKMPI",
        "proteome": "UP000000805",
        "gene": "ptr1",
        "go_terms": [
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "edbc5e38b9170f29926e2b4208a8b2fab4997216",
        "counters": {
            "domain_architectures": 71799,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 71799
        }
    }
}