General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q55BV5",
        "id": "PRS4_DICDI",
        "source_organism": {
            "taxId": "44689",
            "scientificName": "Dictyostelium discoideum",
            "fullName": "Dictyostelium discoideum (Social amoeba)"
        },
        "name": "26S proteasome regulatory subunit 4 homolog",
        "description": [
            "The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex (By similarity). Plays an important role in regulating both growth and multicellular development"
        ],
        "length": 439,
        "sequence": "MGNNQSQGQGDKGEKKDQPKYQPPPPPTQFGKKKKRRGAETSTKLPVITPHSKCKLKQLKLERIKDYLLMEQEFLQNYDLNQPKVDENSKEQADEKIIEELRGDPLTVGNLEEIIDDNHAIVSSTVGPEHYVRIMSFVDKSKLYLGATVLLNNKTLSVVGVIDGEVDPMVNVMKVEKAPTESYSDIGGLEAQVQEMKEAIELPLTHPELYEEIGIKPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADECAPSIVFIDEIDAVGTKRYDSQSGGEREIQRTMLELLNQLDGFDARTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEIHTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVLYRKTAGAPEGLYM",
        "proteome": "UP000002195",
        "gene": "psmC1",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "92960d7fc7923d934aa16eac41a1bcc65675b3ce",
        "counters": {
            "domain_architectures": 20803,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 3,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20803
        }
    }
}