General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q54L63",
        "id": "GATA_DICDI",
        "source_organism": {
            "taxId": "44689",
            "scientificName": "Dictyostelium discoideum",
            "fullName": "Dictyostelium discoideum (Social amoeba)"
        },
        "name": "Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial",
        "description": [
            "Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln)"
        ],
        "length": 550,
        "sequence": "MNRLTNISKIRKSLIDGKLKVNDLVLNKIKEINKVSPNHLNTFISLQDEKSLGKQIKESQERYDNGTNKRLDGIPIGVKDNFSSKNFKTTCGSKILENYIPSFDSTVVKLLKEEGAIIIGKTNMDEFSMGSSSTSGHFGKVINPWSKPNNNNNNDNDNNNNGEVLYVAGGSSGGSAAAVASNYCVASIGSDTGGSIRQPSSYCGVVGFKPSYGLISRFGLVAYASSLDTPGVLTNNVEDAAELLDILIKKDQENDSTSIEFINNNQNQNQNNGEKRNILDEFNEKLKNKNIKDLVFGIPKDYLVKELDTDILNLWKEVVEEIEKRGGKVVSVSLPHTRYALPAYYLLATSEASSNLSRFDGVRYGYRFEEEKDENKVDNDNDDDDDVDENKIGMGLKDMYTKTRTNGFGEEVKKRIILGTMALSRSSYDNFYTKAQKIRRLVSDDFKNVFQGENKVDILITPTAPSPAFKQNEKMDPIEVYVNDIMTIPSNLAGLPACSIPLKLSNSNLPISVQLISNRLTDDNLLFAAHTIMNFDCYKDFTSLTPNYLK",
        "proteome": "UP000002195",
        "gene": "gatA",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050567",
                "name": "glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030956",
                "name": "glutamyl-tRNA(Gln) amidotransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0a45cf887f2349cd96f29ee77337a19c7a275e69",
        "counters": {
            "domain_architectures": 116304,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 116304
        }
    }
}