GET /api/protein/UniProt/Q54HL6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q54HL6",
        "id": "CSN2_DICDI",
        "source_organism": {
            "taxId": "44689",
            "scientificName": "Dictyostelium discoideum",
            "fullName": "Dictyostelium discoideum (Social amoeba)"
        },
        "name": "COP9 signalosome complex subunit 2",
        "description": [
            "Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity"
        ],
        "length": 449,
        "sequence": "MSDDEDMMYDDDEYFDDDEDQDQNDSESEGVEIENQYYNSKGLIDESIPDAIKSYEKVVDLENGEKGEWGFKALKKITKLYFRIGDFDNMLESFKKFLPYTKSSASSNYIEKGINSVLDMVSSSNTIELDMIQKVFDLTLKSLLDTKNERVWFRTNLKLAKLLFEKAEYGRLAKILRDLHKSCELEDGTDDQKKGSQLVDIYALEIQMYTETKNNKKLKDLYKKALEIKSAIPHPRIMGIIRECGGKMHMAEKEWEKAHTDFFEAFKNYDEAGNSRRIQCLKYLVLACMLMLSTINPFDSTEAKPYKNDPDILAMTNLVMAYEKNDIYAFEKILKDNRKTIMDDPFIRMYIEDLLRNIRTQVLLKLLKPYTRIRISFISKELNIPSSDVESLLVSLILDNKIRGSIDQVNQQLELDTAKSSAYWKYTSIHKWANQIGQLNGGINNKLVS",
        "proteome": "UP000002195",
        "gene": "csn2",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "77d30d6d701947e8834a2c894f2861fc8c6070ff",
        "counters": {
            "domain_architectures": 9212,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 2,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9212
        }
    }
}