General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4ZWK9",
        "id": "Q4ZWK9_PSEU2",
        "source_organism": {
            "taxId": "205918",
            "scientificName": "Pseudomonas syringae pv. syringae (strain B728a)",
            "fullName": "Pseudomonas syringae pv. syringae (strain B728a)"
        },
        "name": "Tol-Pal system protein TolQ",
        "description": [
            "Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity"
        ],
        "length": 231,
        "sequence": "MEANVVDHSSMWSLVSNASIVVQLVMLILVAASVTSWIVIFQRSNMLRAGRRALDSFEERFWSGIDLSKLYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQSGVDPDAVMEGVARAMRVAISREEEKLEAGLPYLATVGSTSPYVGLFGTVWGIMNSFRGLATAQQATLATVAPGIAEALIATAIGLFAAIPAVIAYNRFAARSETLISRYYTFADEFQAILHRKVHTSEE",
        "proteome": null,
        "gene": "tolQ",
        "go_terms": [
            {
                "identifier": "GO:0043213",
                "name": "bacteriocin transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d08ac2be9d44bb9e55785ff79602e5c2eb89a2d",
        "counters": {
            "domain_architectures": 51378,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 51378
        }
    }
}