GET /api/protein/UniProt/Q4X160/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q4X160",
"id": "Q4X160_ASPFU",
"source_organism": {
"taxId": "330879",
"scientificName": "Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)",
"fullName": "Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)"
},
"name": "Coupling of ubiquitin conjugation to ER degradation protein 1",
"description": null,
"length": 200,
"sequence": "MPEEEPSLNIPSLLTLAVVSFFVIRWFLKRDGSSDPGAPRARGRGNIVDPAQVEQIAQMFPQLSTREIMWDLQRNGGNVAATTERILSGRGLDMPPPSFQPAIVLPSTTTAPTAASQPSSMSGASLKSDGQDLIARYNLSSKINASDDATSDQSSQKSTSGWSQSKEERQRLLQKRRDDMILAARRRMEQKQRQADNAST",
"proteome": "UP000002530",
"gene": "AFUA_2G11100",
"go_terms": [
{
"identifier": "GO:0043130",
"name": "ubiquitin binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6a1420a2d828932f2dc809150049cfa63156530f",
"counters": {
"domain_architectures": 15330,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15330
}
}
}