GET /api/protein/UniProt/Q4R5E8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q4R5E8",
"id": "Q4R5E8_MACFA",
"source_organism": {
"taxId": "9541",
"scientificName": "Macaca fascicularis",
"fullName": "Macaca fascicularis (Crab-eating macaque)"
},
"name": "Replication factor C subunit 3",
"description": [
"Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA"
],
"length": 356,
"sequence": "MSLWVDKYRPCSLGRLDYHKEQATQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF",
"proteome": "UP000233100",
"gene": "RFC3",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7bd95290fcb68ca8e6dd7aeacc2094dcddfb7a7d",
"counters": {
"domain_architectures": 3665,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 2,
"pfam": 3,
"cdd": 1,
"smart": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3665
}
}
}