General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4R5E8",
        "id": "Q4R5E8_MACFA",
        "source_organism": {
            "taxId": "9541",
            "scientificName": "Macaca fascicularis",
            "fullName": "Macaca fascicularis (Crab-eating macaque)"
        },
        "name": "Replication factor C subunit 3",
        "description": [
            "Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA"
        ],
        "length": 356,
        "sequence": "MSLWVDKYRPCSLGRLDYHKEQATQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF",
        "proteome": "UP000233100",
        "gene": "RFC3",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7bd95290fcb68ca8e6dd7aeacc2094dcddfb7a7d",
        "counters": {
            "domain_architectures": 3665,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "pfam": 3,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3665
        }
    }
}