GET /api/protein/UniProt/Q4PIN7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q4PIN7",
"id": "FKBP4_MYCMD",
"source_organism": {
"taxId": "5270",
"scientificName": "Mycosarcoma maydis",
"fullName": "Mycosarcoma maydis (Corn smut fungus)"
},
"name": "FK506-binding protein 4",
"description": [
"PPIase that acts as a histone chaperone. Histone proline isomerase that increases the rate of cis-trans isomerization at prolines on the histone H3 N-terminal tail. Proline isomerization influences H3 methylation thereby regulating gene expression"
],
"length": 375,
"sequence": "MSATPIGFFGLKLVPGKVHRMDVSRDFKITNVSYADQPKSNTKTLVKIHYTHVPGFEDDYDEEEQEKEPKSTDEEEEIEEKVYTLCSLNGANKDHAVVDLQFCQEELIGFSITGDAPVDLVGNYVAPPDFFDQDPSDSELYSDDEDDDEDMYGLDSDDFDDDDDDDMDEDPDRFEELVESSASKPKKAIEAAPLADSKKRAAEKPVKETAAKKLKADASAASAASTPTKAIETKGEKQTKGAKDTKPKSETVEKKTVDKSTSKMTTTKLPSGLVIEEKSAGSGPPCKAGQKVGMRYVGKLTNGKVFDQCTSGKPFYFKLGKGEVIKGWDEGVKGMRVGAERRLTCPPKLAYGNQKIPGIPANSTLVFDVKLVEIK",
"proteome": "UP000000561",
"gene": "FPR4",
"go_terms": [
{
"identifier": "GO:0003755",
"name": "peptidyl-prolyl cis-trans isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a9bcf2e27d9c54b6324e0cf4ab48ab1b98a12383",
"counters": {
"domain_architectures": 3297,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 1,
"profile": 1,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3297
}
}
}