GET /api/protein/UniProt/Q4PIN7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4PIN7",
        "id": "FKBP4_MYCMD",
        "source_organism": {
            "taxId": "5270",
            "scientificName": "Mycosarcoma maydis",
            "fullName": "Mycosarcoma maydis (Corn smut fungus)"
        },
        "name": "FK506-binding protein 4",
        "description": [
            "PPIase that acts as a histone chaperone. Histone proline isomerase that increases the rate of cis-trans isomerization at prolines on the histone H3 N-terminal tail. Proline isomerization influences H3 methylation thereby regulating gene expression"
        ],
        "length": 375,
        "sequence": "MSATPIGFFGLKLVPGKVHRMDVSRDFKITNVSYADQPKSNTKTLVKIHYTHVPGFEDDYDEEEQEKEPKSTDEEEEIEEKVYTLCSLNGANKDHAVVDLQFCQEELIGFSITGDAPVDLVGNYVAPPDFFDQDPSDSELYSDDEDDDEDMYGLDSDDFDDDDDDDMDEDPDRFEELVESSASKPKKAIEAAPLADSKKRAAEKPVKETAAKKLKADASAASAASTPTKAIETKGEKQTKGAKDTKPKSETVEKKTVDKSTSKMTTTKLPSGLVIEEKSAGSGPPCKAGQKVGMRYVGKLTNGKVFDQCTSGKPFYFKLGKGEVIKGWDEGVKGMRVGAERRLTCPPKLAYGNQKIPGIPANSTLVFDVKLVEIK",
        "proteome": "UP000000561",
        "gene": "FPR4",
        "go_terms": [
            {
                "identifier": "GO:0003755",
                "name": "peptidyl-prolyl cis-trans isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a9bcf2e27d9c54b6324e0cf4ab48ab1b98a12383",
        "counters": {
            "domain_architectures": 3297,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 1,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3297
        }
    }
}