General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4L6M7",
        "id": "Q4L6M7_STAHJ",
        "source_organism": {
            "taxId": "279808",
            "scientificName": "Staphylococcus haemolyticus (strain JCSC1435)",
            "fullName": "Staphylococcus haemolyticus (strain JCSC1435)"
        },
        "name": "Biotin carboxylase",
        "description": [
            "This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA"
        ],
        "length": 451,
        "sequence": "MKKILIANRGEIAVRIIRACHDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTQSKDSYLNIPNILSIATSTGCDGIHPGYGFLAENGDFAELCEACQLKFIGPSYESIQKMGIKDIAKAEMIAANVPVVPGSDGLVTTISDAKQIAKEIGYPVIIKATAGGGGKGIRVARTEKELENGYRMTQQEAETAFGNGGLYLEKFIENFRHIEIQIIGDQHGNVIHLGERDCTIQRRMQKLVEESPSPILSDEQREEMGNAAIRAAKAVNYENAGTIEFIYDLNDNQFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLKVAMGEALPYTQEDITINGHAIEYRINAENPYKNFMPSPGKITQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIVHEPTRDEAIMTGLRALSEYLILGIDTTIPFHLKLMNNDIFRSGSFNTNFLEQYNIMDDEE",
        "proteome": null,
        "gene": "accC",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016874",
                "name": "ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "07128f2a23af4ed0effa7a056c6eaf24f2e4a951",
        "counters": {
            "domain_architectures": 27831,
            "entries": 27,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 3,
                "ssf": 3,
                "profile": 2,
                "smart": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 2,
                "interpro": 10
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27831
        }
    }
}